PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim11g072500.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 286aa    MW: 32419.9 Da    PI: 7.4733
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim11g072500.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.81.3e-393898262
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        +++ +kcprCds+ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rkn+k s
  Sopim11g072500.0.1 38 EQQPQKCPRCDSANTKFCYYNNYSLTQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNRKLS 98
                        57899****************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-303796IPR003851Zinc finger, Dof-type
PfamPF027016.0E-334096IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0314296IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104480IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MCIMDHHQQE MTSQTLESML VCAKPDQDQK KPRPAAAEQQ PQKCPRCDSA NTKFCYYNNY  60
SLTQPRYFCK SCRRYWTKGG TLRNVPVGGG CRKNRKLSSA KRSSQDNISP NSSNSSTDLS  120
LAFARLQKQT NAIDQEQDTN NNMSMMYNTN NDNTSTTFLD ALRGGFLENH HGLFQHNMYN  180
YANMGQLVEN GEMGLSYDQD QMSIGTMMTT TMKQEMCNVA RSTEGHDLND NNKVLWGFPW  240
QQMSGDHHVN NNMNTNDFEY STNKQSWNGF GGSSNWHGLI NSPLM*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755230.0HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004251272.10.0PREDICTED: dof zinc finger protein DOF5.3
TrEMBLK4DAV70.0K4DAV7_SOLLC; Uncharacterized protein
STRINGSolyc11g072500.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-45TARGET OF MONOPTEROS 6